PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18735
Common NameKK1_019282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 301aa    MW: 34180.1 Da    PI: 6.9592
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18735genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++q+G g+W++ ++  g+ R++k+c++rw +yl
    C.cajan_18735 14 KGPWTPEEDQKLLAYIEQHGHGSWRAFPANAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.41.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
    C.cajan_18735  67 RGKFSMQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.944961IPR017930Myb domain
SuperFamilySSF466891.31E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001671.93E-101661No hitNo description
PROSITE profilePS5129425.53662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002495.6E-1667112IPR001005SANT/Myb domain
CDDcd001679.99E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE QHGHGSWRAF PANAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SMQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLDKMG  120
IDPWESARLE AEARLVRESK LRTSASTLPL PPSHHAIATR VSDLDESSTS TLSENNATTI  180
MSSVVDFNVK EEEEWKGSTN MGEYKDEMEN SMPFTSSLHD LTMTMTSAST AHAHAHVHVE  240
GFTTLLLNTN NADRTERDSN ITNSHHCNHG GADLYEDNNK HYWNNIINLM NYSSPSDSPM  300
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0936131e-123BT093613.1 Soybean clone JCVI-FLGm-24C14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139534.11e-143hypothetical protein PHAVU_008G038000g
TrEMBLA0A151TCB20.0A0A151TCB2_CAJCA; Myb-related protein Myb4
STRINGGLYMA09G37040.21e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-100myb domain protein 16